Recombinant Mouse Ras GTPase-activating protein-binding protein 1 (G3bp1)

Catalog Number: CSB-EP009116MO
Article Name: Recombinant Mouse Ras GTPase-activating protein-binding protein 1 (G3bp1)
Biozol Catalog Number: CSB-EP009116MO
Supplier Catalog Number: CSB-EP009116MO
Alternative Catalog Number: CSB-EP009116MO-1, CSB-EP009116MO-100, CSB-EP009116MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ATP-dependent DNA helicase VIII,GAP SH3 domain-binding protein 1,HDH-VIII
Molecular Weight: 58.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P97855
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-465aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYAHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQTVSNDLEEHLEEPVVEPEPEPEPEPEPEPVSDIQEDKPEAALEEAAPDDVQKSTSPAPADVAPAQEDLRTFSWASVTSK
Application Notes: Research Areas: Cancer. Endotoxin: Not test