Recombinant Glycine max Gamma-glutamyl hydrolase
Catalog Number:
CSB-EP009389GGV
- Images (0)
| Article Name: | Recombinant Glycine max Gamma-glutamyl hydrolase |
| Biozol Catalog Number: | CSB-EP009389GGV |
| Supplier Catalog Number: | CSB-EP009389GGV |
| Alternative Catalog Number: | CSB-EP009389GGV-1, CSB-EP009389GGV-100, CSB-EP009389GGV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Conjugase GH Gamma-Glu-X carboxypeptidase |
| Molecular Weight: | 51.3 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P93164 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 22-342aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEW |
Product Guarantee and Expert Support
