Recombinant Human Glioma pathogenesis-related protein 1 (GLIPR1), partial

Catalog Number: CSB-EP009503HU
Article Name: Recombinant Human Glioma pathogenesis-related protein 1 (GLIPR1), partial
Biozol Catalog Number: CSB-EP009503HU
Supplier Catalog Number: CSB-EP009503HU
Alternative Catalog Number: CSB-EP009503HU-1, CSB-EP009503HU-100, CSB-EP009503HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Protein RTVP-1
Molecular Weight: 28.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P48060
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 22-232aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR