Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial
Catalog Number:
CSB-EP009514HU
- Images (0)
| Article Name: | Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial |
| Biozol Catalog Number: | CSB-EP009514HU |
| Supplier Catalog Number: | CSB-EP009514HU |
| Alternative Catalog Number: | CSB-EP009514HU-1, CSB-EP009514HU-100, CSB-EP009514HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340 |
| Molecular Weight: | 18.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P43220 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-145aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Product Guarantee and Expert Support
