Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Catalog Number: CSB-EP009514HU
Article Name: Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial
Biozol Catalog Number: CSB-EP009514HU
Supplier Catalog Number: CSB-EP009514HU
Alternative Catalog Number: CSB-EP009514HU-1, CSB-EP009514HU-100, CSB-EP009514HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340
Molecular Weight: 18.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P43220
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 24-145aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY