Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial

Catalog Number: CSB-EP009514MO1
Article Name: Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial
Biozol Catalog Number: CSB-EP009514MO1
Supplier Catalog Number: CSB-EP009514MO1
Alternative Catalog Number: CSB-EP009514MO1-1, CSB-EP009514MO1-100, CSB-EP009514MO1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Molecular Weight: 30.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: O35659
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 22-145aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.