Recombinant Mouse Glutathione peroxidase 3 (Gpx3) (U73S)

Catalog Number: CSB-EP009868MO(M)
Article Name: Recombinant Mouse Glutathione peroxidase 3 (Gpx3) (U73S)
Biozol Catalog Number: CSB-EP009868MO(M)
Supplier Catalog Number: CSB-EP009868MO(M)
Alternative Catalog Number: CSB-EP009868MO(M)-1, CSB-EP009868MO(M)-100, CSB-EP009868MO(M)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Plasma glutathione peroxidase
Molecular Weight: 29.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P46412
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 25-226aa(U73S)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYSGLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
Application Notes: Research Areas: Cancer. Endotoxin: Not test