Recombinant Human Glutathione S-transferase Mu 3 (GSTM3)

Catalog Number: CSB-EP009982HUC7
Article Name: Recombinant Human Glutathione S-transferase Mu 3 (GSTM3)
Biozol Catalog Number: CSB-EP009982HUC7
Supplier Catalog Number: CSB-EP009982HUc7
Alternative Catalog Number: CSB-EP009982HUC7-1, CSB-EP009982HUC7-100, CSB-EP009982HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: GST class-mu 3,GSTM3-3
Molecular Weight: 33.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P21266
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-225aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Application Notes: Research Areas: Metabolism. Endotoxin: Not test