Recombinant Human Histone H2A.J (H2AJ)

Catalog Number: CSB-EP010094HUC7
Article Name: Recombinant Human Histone H2A.J (H2AJ)
Biozol Catalog Number: CSB-EP010094HUC7
Supplier Catalog Number: CSB-EP010094HUc7
Alternative Catalog Number: CSB-EP010094HUC7-1, CSB-EP010094HUC7-100, CSB-EP010094HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: H2a/j,H2AJ ,H2AFJ
Molecular Weight: 19.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9BTM1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-129aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Application Notes: Research Areas: Epigenetics and Nuclear Signaling. Endotoxin: Not test