Recombinant Drosophila melanogaster Histone H2A.v (His2Av)

Catalog Number: CSB-EP010095DLU
Article Name: Recombinant Drosophila melanogaster Histone H2A.v (His2Av)
Biozol Catalog Number: CSB-EP010095DLU
Supplier Catalog Number: CSB-EP010095DLU
Alternative Catalog Number: CSB-EP010095DLU-1, CSB-EP010095DLU-100, CSB-EP010095DLU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: H2A.F/Z
Molecular Weight: 21.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08985
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.113.
Source: E.coli
Expression System: 2-141aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQDPQRKGNVILSQAY
Application Notes: Research Areas: Others