Recombinant Human Histone acetyltransferase type B catalytic subunit (HAT1)

Catalog Number: CSB-EP010143HU
Article Name: Recombinant Human Histone acetyltransferase type B catalytic subunit (HAT1)
Biozol Catalog Number: CSB-EP010143HU
Supplier Catalog Number: CSB-EP010143HU
Alternative Catalog Number: CSB-EP010143HU-1, CSB-EP010143HU-100, CSB-EP010143HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Histone acetyltransferase 1
Molecular Weight: 56.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O14929
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.153.
Source: E.coli
Expression System: 2-419aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQL
Application Notes: Research Areas: Epigenetics and Nuclear Signaling