Recombinant Mouse Helicase-like transcription factor (Hltf), partial

Catalog Number: CSB-EP010520MO
Article Name: Recombinant Mouse Helicase-like transcription factor (Hltf), partial
Biozol Catalog Number: CSB-EP010520MO
Supplier Catalog Number: CSB-EP010520MO
Alternative Catalog Number: CSB-EP010520MO-1, CSB-EP010520MO-100, CSB-EP010520MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: P113,RING-type E3 ubiquitin transferase HLTF,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3,Sucrose nonfermenting protein 2-like 3,TNF-response element-binding protein
Molecular Weight: 26.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q6PCN7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.152.
Source: E.coli
Expression System: 433-600aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DSKFALTFFASATQRKMLKKGMSMMECSEACDTGERTRATLIICPLSVLSNWIDQFGQHVKSEVHLNFYVYYGPDRIRDSAWLSKQDIILTTYNILTHDYGTKDDSPLHSIKWLRVILDEGHAIRNPNAQQTKAVLELEAERRWVLTGTPIQNSLKDLWSLLSFLKLK
Application Notes: Research Areas: Cancer