Recombinant Dog Haptoglobin (HP)

Catalog Number: CSB-EP010691DO
Article Name: Recombinant Dog Haptoglobin (HP)
Biozol Catalog Number: CSB-EP010691DO
Supplier Catalog Number: CSB-EP010691DO
Alternative Catalog Number: CSB-EP010691DO-1, CSB-EP010691DO-100, CSB-EP010691DO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 43.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P19006
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.261.
Source: E.coli
Expression System: 1-329aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDTGSEATNNTEVSLPKPPVIENGYVEHMIRYQCKPFYKLHTEGDGVYTLNSEKHWTNKAVGEKLPECEAVCGKPKNPVDQVQRIMGGSVDAKGSFPWQAKMVSHHNLTSGATLINEQWLLTTAKNLFLGHKDDAKANDIAPTLKLYVGKNQLVEVEKVVLHPDYSKVDIGLIKLKQKVPIDERVMPICLPSKDYAEVGRIGYVSGWGRNSNFNFTELLKYVMLPVADQDKCVQHYEGSTVPEKKSPKSPVGVQP
Application Notes: Research Areas: Others