Recombinant Human Interleukin-13 receptor subunit alpha-1 (IL13RA1), partial

Catalog Number: CSB-EP011591HU2
Article Name: Recombinant Human Interleukin-13 receptor subunit alpha-1 (IL13RA1), partial
Biozol Catalog Number: CSB-EP011591HU2
Supplier Catalog Number: CSB-EP011591HU2
Alternative Catalog Number: CSB-EP011591HU2-1, CSB-EP011591HU2-100, CSB-EP011591HU2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cancer/testis antigen 19
Molecular Weight: 13.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P78552
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.144.
Source: E.coli
Expression System: 368-427aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENLKKASQ
Application Notes: Research Areas: Immunology