Recombinant Bovine Interleukin-1 alpha (IL1A)

Catalog Number: CSB-EP011613BO
Article Name: Recombinant Bovine Interleukin-1 alpha (IL1A)
Biozol Catalog Number: CSB-EP011613BO
Supplier Catalog Number: CSB-EP011613BO
Alternative Catalog Number: CSB-EP011613BO-1, CSB-EP011613BO-100, CSB-EP011613BO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 24.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08831
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.105.
Source: E.coli
Expression System: 113-268aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK
Application Notes: Research Areas: Immunology