Recombinant Rat Interleukin-7 (Il7)

Catalog Number: CSB-EP011669RA
Article Name: Recombinant Rat Interleukin-7 (Il7)
Biozol Catalog Number: CSB-EP011669RA
Supplier Catalog Number: CSB-EP011669RA
Alternative Catalog Number: CSB-EP011669RA-1, CSB-EP011669RA-100, CSB-EP011669RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 21.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P56478
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.208.
Source: E.coli
Expression System: 26-154aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI
Application Notes: Research Areas: Immunology