Recombinant Mouse Kininogen-1 (Kng1)

Catalog Number: CSB-EP012479MO(F2)
Article Name: Recombinant Mouse Kininogen-1 (Kng1)
Biozol Catalog Number: CSB-EP012479MO(F2)
Supplier Catalog Number: CSB-EP012479MO(F2)
Alternative Catalog Number: CSB-EP012479MO(F2)-1, CSB-EP012479MO(F2)-100, CSB-EP012479MO(F2)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 48.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged
UniProt: O08677
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.186.
Source: E.coli
Expression System: 21-432aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVIEGTKTDGSPTFYSFKYLIKEGNCSAQSGLAWQDCDFKDAEEAATGECTATVGKRENEFFIVTQTCKIAPSKAPILKAYFPCIGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRKVKSAHRQVVAGLNFDITYTIVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKIANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSP
Application Notes: Research Areas: Signal Transduction