Recombinant Mouse Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial

Catalog Number: CSB-EP012911MO
Article Name: Recombinant Mouse Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial
Biozol Catalog Number: CSB-EP012911MO
Supplier Catalog Number: CSB-EP012911MO
Alternative Catalog Number: CSB-EP012911MO-1, CSB-EP012911MO-100, CSB-EP012911MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Luteinizing hormone receptor
Molecular Weight: 44.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P30730
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.244.
Source: E.coli
Expression System: 27-362aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSEILIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVSKISSSEFNFILEICDNLYITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGTFQGATGPSILDVSSTKLQALPSHGLESIQTLIATSSYSLKTLPSREKFTSLLVATLTYPS
Application Notes: Research Areas: Signal Transduction