Recombinant Human Lysyl oxidase homolog 1 (LOXL1)

Catalog Number: CSB-EP013040HU(A4)A2
Article Name: Recombinant Human Lysyl oxidase homolog 1 (LOXL1)
Biozol Catalog Number: CSB-EP013040HU(A4)A2
Supplier Catalog Number: CSB-EP013040HU(A4)a2
Alternative Catalog Number: CSB-EP013040HU(A4)A2-1, CSB-EP013040HU(A4)A2-100, CSB-EP013040HU(A4)A2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Lysyl oxidase-like protein 1
Molecular Weight: 71.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q08397
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.229.
Source: E.coli
Expression System: 95-574aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RQAPSLPLPGRVGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYYRPAGGGVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGA
Application Notes: Research Areas: Metabolism