Recombinant Human Stromelysin-1 (MMP3)

Catalog Number: CSB-EP014676HU(A4)
Article Name: Recombinant Human Stromelysin-1 (MMP3)
Biozol Catalog Number: CSB-EP014676HU(A4)
Supplier Catalog Number: CSB-EP014676HU(A4)
Alternative Catalog Number: CSB-EP014676HU(A4)-1, CSB-EP014676HU(A4)-100, CSB-EP014676HU(A4)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Matrix metalloproteinase-3,Transin-1
Molecular Weight: 49.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08254
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.197.
Source: E.coli
Expression System: 100-477aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFI
Application Notes: Research Areas: Cancer