Recombinant Human Protein Mpv17 (MPV17)

Catalog Number: CSB-EP014771HUC7
Article Name: Recombinant Human Protein Mpv17 (MPV17)
Biozol Catalog Number: CSB-EP014771HUC7
Supplier Catalog Number: CSB-EP014771HUc7
Alternative Catalog Number: CSB-EP014771HUC7-1, CSB-EP014771HUC7-100, CSB-EP014771HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Protein Mpv17
Molecular Weight: 25.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P39210
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-176aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
Application Notes: Research Areas: Metabolism. Endotoxin: Not test