Recombinant Escherichia coli Ribosome-recycling factor (frr)

Catalog Number: CSB-EP014941ENV
Article Name: Recombinant Escherichia coli Ribosome-recycling factor (frr)
Biozol Catalog Number: CSB-EP014941ENV
Supplier Catalog Number: CSB-EP014941ENV
Alternative Catalog Number: CSB-EP014941ENV-1, CSB-EP014941ENV-100, CSB-EP014941ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Ribosome-releasing factor
Molecular Weight: 27.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A805
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.133.
Source: E.coli
Expression System: 1-185aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF
Application Notes: Research Areas: Others