Recombinant Rat Metallothionein-3 (Mt3)

Catalog Number: CSB-EP015122RA
Article Name: Recombinant Rat Metallothionein-3 (Mt3)
Biozol Catalog Number: CSB-EP015122RA
Supplier Catalog Number: CSB-EP015122RA
Alternative Catalog Number: CSB-EP015122RA-1, CSB-EP015122RA-100, CSB-EP015122RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Growth inhibitory factor,Metallothionein-III
Molecular Weight: 25.0 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P37361
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-66aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEKCSCCQ
Application Notes: Research Areas: Neuroscience