Recombinant Escherichia coli Translation initiation factor IF-3 (infC)

Catalog Number: CSB-EP015166ENV
Article Name: Recombinant Escherichia coli Translation initiation factor IF-3 (infC)
Biozol Catalog Number: CSB-EP015166ENV
Supplier Catalog Number: CSB-EP015166ENV
Alternative Catalog Number: CSB-EP015166ENV-1, CSB-EP015166ENV-100, CSB-EP015166ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 27.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A707
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.135.
Source: E.coli
Expression System: 1-180aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKGGKRVQTARPNRINGEIRAQEVRLTGLEGEQLGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFPTKIEGRQMIMVLAPKKKQ
Application Notes: Research Areas: Others