Recombinant Drosophila melanogaster Nucleoside diphosphate kinase (awd)

Catalog Number: CSB-EP015889DLU
Article Name: Recombinant Drosophila melanogaster Nucleoside diphosphate kinase (awd)
Biozol Catalog Number: CSB-EP015889DLU
Supplier Catalog Number: CSB-EP015889DLU
Alternative Catalog Number: CSB-EP015889DLU-1, CSB-EP015889DLU-100, CSB-EP015889DLU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Abnormal wing disks protein,Killer of prune protein
Molecular Weight: 44.5 kDa
Tag: N-terminal GST-tagged
UniProt: P08879
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-153aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE
Application Notes: Research Areas: Others. Endotoxin: Not test