Recombinant Human Neuromedin-U (NMU)

Catalog Number: CSB-EP015902HU
Article Name: Recombinant Human Neuromedin-U (NMU)
Biozol Catalog Number: CSB-EP015902HU
Supplier Catalog Number: CSB-EP015902HU
Alternative Catalog Number: CSB-EP015902HU-1, CSB-EP015902HU-100, CSB-EP015902HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: NMU
Molecular Weight: 23.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P48645
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 35-174aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Application Notes: Research Areas: Cancer. Endotoxin: Not test