Recombinant Rat Natriuretic peptides B (Nppb), partial

Catalog Number: CSB-EP016021RA1
Article Name: Recombinant Rat Natriuretic peptides B (Nppb), partial
Biozol Catalog Number: CSB-EP016021RA1
Supplier Catalog Number: CSB-EP016021RA1
Alternative Catalog Number: CSB-EP016021RA1-1, CSB-EP016021RA1-100, CSB-EP016021RA1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Brain natriuretic factor prohormone,Gamma-brain natriuretic peptide,Iso-ANP
Molecular Weight: 12.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P13205
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.237.
Source: E.coli
Expression System: 77-121aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Application Notes: Research Areas: Cardiovascular