Recombinant Human Nuclear pore complex protein Nup153 (NUP153), partial

Catalog Number: CSB-EP016190HUC7
Article Name: Recombinant Human Nuclear pore complex protein Nup153 (NUP153), partial
Biozol Catalog Number: CSB-EP016190HUC7
Supplier Catalog Number: CSB-EP016190HUc7
Alternative Catalog Number: CSB-EP016190HUC7-1, CSB-EP016190HUC7-100, CSB-EP016190HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 153 kDa nucleoporin,Nucleoporin Nup153
Molecular Weight: 30.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P49790
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.192.
Source: E.coli
Expression System: 657-880aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG
Application Notes: Research Areas: Immunology