Recombinant Human Progesterone receptor (PGR), partial

Catalog Number: CSB-EP017875HU3
Article Name: Recombinant Human Progesterone receptor (PGR), partial
Biozol Catalog Number: CSB-EP017875HU3
Supplier Catalog Number: CSB-EP017875HU3
Alternative Catalog Number: CSB-EP017875HU3-1, CSB-EP017875HU3-100, CSB-EP017875HU3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Nuclear receptor subfamily 3 group C member 3,PR
Molecular Weight: 16.9 kDa
Tag: N-terminal 6xHis-ABP-tagged
UniProt: P06401
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 323-419aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL
Application Notes: Research Areas: Others. Endotoxin: Not test