Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5

Catalog Number: CSB-EP018091NHT
Article Name: Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5
Biozol Catalog Number: CSB-EP018091NHT
Supplier Catalog Number: CSB-EP018091NHT
Alternative Catalog Number: CSB-EP018091NHT-1,CSB-EP018091NHT-100,CSB-EP018091NHT-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Phosphatidylcholine 2-acylhydrolase
Molecular Weight: 20.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P00609
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-119aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NLVQFSYLIQCANHGRRPTRHYMDYGCYCGWGGSGTPVDELDRCCKIHDDCYSDAEKKGCSPKMSAYDYYCGENGPYCRNIKKKCLRFVCDCDVEAAFCFAKAPYNNANWNIDTKKRCQ
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.