Recombinant Rat Calcium-dependent phospholipase A2 (Pla2g5)

Catalog Number: CSB-EP018103RA
Article Name: Recombinant Rat Calcium-dependent phospholipase A2 (Pla2g5)
Biozol Catalog Number: CSB-EP018103RA
Supplier Catalog Number: CSB-EP018103RA
Alternative Catalog Number: CSB-EP018103RA-1, CSB-EP018103RA-100, CSB-EP018103RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Group V phospholipase A2,PLA2-10Phosphatidylcholine 2-acylhydrolase 5
Molecular Weight: 29.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P51433
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 21-137aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC