Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial

Catalog Number: CSB-EP018107MO1
Article Name: Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial
Biozol Catalog Number: CSB-EP018107MO1
Supplier Catalog Number: CSB-EP018107MO1
Alternative Catalog Number: CSB-EP018107MO1-1, CSB-EP018107MO1-100, CSB-EP018107MO1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: PLA2P (PLAP) (Plap)
Molecular Weight: 14.7 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P27612
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 495-584aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.