Recombinant Mouse Urokinase-type plasminogen activator(Plau),Escherichia Coli Preis auf Anfrage

Product Overview

• Article Name: Recombinant Mouse Urokinase-type plasminogen activator(Plau),Escherichia Coli Preis auf Anfrage
• Biozol Catalog Number: CSB-EP018121MO
• Supplier Catalog Number: CSB-EP018121MO
• Alternative Catalog Number: CSB-EP018121MO-1, CSB-EP018121MO-100, CSB-EP018121MO-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Alternative Names: Recommended name: Urokinase-type plasminogen activator Short name= U-plasminogen activator Short name= uPA EC= 3.4.21.73Cleaved into the following 3 chains: 1. Urokinase-type plasminogen activator long chain A 2. Urokinase-type plasminogen activator short chain A 3. Urokinase-type plasminogen activator chain B

Product Properties

• Tag: The tag type will be determined during production process.
• UniProt: P06869
• Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: E.coli
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: GSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYR GKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGL RQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQK NKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQ LILHEYYREDS

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.