Recombinant Human Phospholipid transfer protein (PLTP)

Catalog Number: CSB-EP018212HU
Article Name: Recombinant Human Phospholipid transfer protein (PLTP)
Biozol Catalog Number: CSB-EP018212HU
Supplier Catalog Number: CSB-EP018212HU
Alternative Catalog Number: CSB-EP018212HU-1, CSB-EP018212HU-100, CSB-EP018212HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Lipid transfer protein II
Molecular Weight: 80.1 kDa
Tag: N-terminal GST-tagged
UniProt: P55058
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 18-493aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFF
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.