Recombinant Human Protein PML (PML), partial
Catalog Number:
CSB-EP018236HUA0
- Images (0)
| Article Name: | Recombinant Human Protein PML (PML), partial |
| Biozol Catalog Number: | CSB-EP018236HUA0 |
| Supplier Catalog Number: | CSB-EP018236HUa0 |
| Alternative Catalog Number: | CSB-EP018236HUA0-1, CSB-EP018236HUA0-100, CSB-EP018236HUA0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Promyelocytic leukemia protein (RING finger protein 71) (Tripartite motif-containing protein 19) (MYL) (PP8675) (RNF71) (TRIM19) |
| Molecular Weight: | 26.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P29590 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 59-239aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE |
Product Guarantee and Expert Support
