Recombinant Human Phosphomannomutase 2 (PMM2)
Catalog Number:
CSB-EP018238HU
- Images (0)
| Article Name: | Recombinant Human Phosphomannomutase 2 (PMM2) |
| Biozol Catalog Number: | CSB-EP018238HU |
| Supplier Catalog Number: | CSB-EP018238HU |
| Alternative Catalog Number: | CSB-EP018238HU-1, CSB-EP018238HU-100, CSB-EP018238HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | AI585868, BOS_22465, C86848, CDG 1, CDG1, CDG1a, CDGS, MGC127449, Phosphomannomutase 2, PMM 2, Pmm2, PMM2_HUMAN |
| Molecular Weight: | 55 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | O15305 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-246aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS |
Product Guarantee and Expert Support
