Recombinant Mouse Peroxiredoxin-6 (Prdx6)

Catalog Number: CSB-EP018659MO
Article Name: Recombinant Mouse Peroxiredoxin-6 (Prdx6)
Biozol Catalog Number: CSB-EP018659MO
Supplier Catalog Number: CSB-EP018659MO
Alternative Catalog Number: CSB-EP018659MO-1, CSB-EP018659MO-100, CSB-EP018659MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 1-Cys peroxiredoxin,1-Cys PRX,Acidic calcium-independent phospholipase A2,aiPLA2,EC 3.1.1.4,Antioxidant protein 2,Glutathione-dependent peroxiredoxin,Lysophosphatidylcholine acyltransferase 5,LPC acyltransferase 5,LPCAT-5,Lyso-PC acyltransferase 5,EC 2.3.1.23,Non-selenium glutathione peroxidase,NSGPx
Molecular Weight: 31.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O08709
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-224aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.