Recombinant Mouse Peroxiredoxin-6 (Prdx6)

Catalog Number: CSB-EP018659MO
Article Name: Recombinant Mouse Peroxiredoxin-6 (Prdx6)
Biozol Catalog Number: CSB-EP018659MO
Supplier Catalog Number: CSB-EP018659MO
Alternative Catalog Number: CSB-EP018659MO-1,CSB-EP018659MO-100,CSB-EP018659MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: 1-Cys peroxiredoxin,1-Cys PRX,Acidic calcium-independent phospholipase A2,aiPLA2,EC 3.1.1.4,Antioxidant protein 2,Glutathione-dependent peroxiredoxin,Lysophosphatidylcholine acyltransferase 5,LPC acyltransferase 5,LPCAT-5,Lyso-PC acyltransferase 5,EC 2.3.1.23,Non-selenium glutathione peroxidase,NSGPx
Molecular Weight: 31.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O08709
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-224aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.