Recombinant Human Prolyl endopeptidase (PREP), partial

Catalog Number: CSB-EP018664HU
Article Name: Recombinant Human Prolyl endopeptidase (PREP), partial
Biozol Catalog Number: CSB-EP018664HU
Supplier Catalog Number: CSB-EP018664HU
Alternative Catalog Number: CSB-EP018664HU-1, CSB-EP018664HU-100, CSB-EP018664HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (PE)(Post-proline cleaving enzyme)
Molecular Weight: 88.0 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P48147
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-710aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCD
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.