Recombinant Chicken Pleiotrophin (PTN)

Catalog Number: CSB-EP019009CH
Article Name: Recombinant Chicken Pleiotrophin (PTN)
Biozol Catalog Number: CSB-EP019009CH
Supplier Catalog Number: CSB-EP019009CH
Alternative Catalog Number: CSB-EP019009CH-1, CSB-EP019009CH-100, CSB-EP019009CH-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Heparin-binding brain mitogen,Heparin-binding growth factor 8,Heparin-binding growth-associated molecule,Heparin-binding neutrophic factor,Osteoblast-specific factor 1
Molecular Weight: 22.1 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P32760
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.141.
Source: E.coli
Expression System: 31-165aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GKKEKPEKKAKKSDCGEWQWSVCVPTNGDCGLGTREGTRTGAECKQTTKTQKCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGNLKRALHNADCQKTVTISKPCGKLTKPKPQESKKKKKEGKKQEKMLD
Application Notes: Research Areas: Others