Recombinant Human E3 ubiquitin-protein ligase RNF13 (RNF13), partial
Catalog Number:
CSB-EP019831HU1
- Images (0)
| Article Name: | Recombinant Human E3 ubiquitin-protein ligase RNF13 (RNF13), partial |
| Biozol Catalog Number: | CSB-EP019831HU1 |
| Supplier Catalog Number: | CSB-EP019831HU1 |
| Alternative Catalog Number: | CSB-EP019831HU1-1, CSB-EP019831HU1-100, CSB-EP019831HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (RING finger protein 13)(RING-type E3 ubiquitin transferase RNF13) |
| Molecular Weight: | 26.2 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O43567 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 204-381aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV |
Product Guarantee and Expert Support
