Recombinant Human RING-box protein 2 (RNF7)

Catalog Number: CSB-EP019897HU
Article Name: Recombinant Human RING-box protein 2 (RNF7)
Biozol Catalog Number: CSB-EP019897HU
Supplier Catalog Number: CSB-EP019897HU
Alternative Catalog Number: CSB-EP019897HU-1, CSB-EP019897HU-100, CSB-EP019897HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CKII beta-binding protein 1 ,CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein
Molecular Weight: 39.6 kDa
Tag: N-terminal GST-tagged
UniProt: Q9UBF6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-113aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK