Recombinant Human Secreted frizzled-related protein 2 (SFRP2),partial

Catalog Number: CSB-EP021139HU1C7
Article Name: Recombinant Human Secreted frizzled-related protein 2 (SFRP2),partial
Biozol Catalog Number: CSB-EP021139HU1C7
Supplier Catalog Number: CSB-EP021139HU1c7
Alternative Catalog Number: CSB-EP021139HU1C7-1, CSB-EP021139HU1C7-100, CSB-EP021139HU1C7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Secreted apoptosis-related protein 1
Molecular Weight: 20.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q96HF1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.203.
Source: E.coli
Expression System: 68-186aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM
Application Notes: Research Areas: Cancer