Recombinant Human SHC-transforming protein 1 (SHC1), partial, Biotinylated

Catalog Number: CSB-EP021253HU1-B
Article Name: Recombinant Human SHC-transforming protein 1 (SHC1), partial, Biotinylated
Biozol Catalog Number: CSB-EP021253HU1-B
Supplier Catalog Number: CSB-EP021253HU1-B
Alternative Catalog Number: CSB-EP021253HU1-B-1, CSB-EP021253HU1-B-100, CSB-EP021253HU1-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (SHC-transforming protein 3)(SHC-transforming protein A)(Src homology 2 domain-containing-transforming protein C1)(SH2 domain protein C1)
Molecular Weight: 66.4 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: P29353
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 150-320aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.