Recombinant Human Transcription factor Sp1 (SP1)

Catalog Number: CSB-EP022438HU
Article Name: Recombinant Human Transcription factor Sp1 (SP1)
Biozol Catalog Number: CSB-EP022438HU
Supplier Catalog Number: CSB-EP022438HU
Alternative Catalog Number: CSB-EP022438HU-1, CSB-EP022438HU-100, CSB-EP022438HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: SP1,TSFP1
Molecular Weight: 87.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08047
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-785aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNV
Application Notes: Research Areas: Cancer