Recombinant Human Osteopontin (SPP1), partial

Catalog Number: CSB-EP022603HU3
Article Name: Recombinant Human Osteopontin (SPP1), partial
Biozol Catalog Number: CSB-EP022603HU3
Supplier Catalog Number: CSB-EP022603HU3
Alternative Catalog Number: CSB-EP022603HU3-1, CSB-EP022603HU3-100, CSB-EP022603HU3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Bone sialoprotein 1,Nephropontin,Secreted phosphoprotein 1,Urinary stone protein,Uropontin
Molecular Weight: 17.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P10451
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.82.
Source: E.coli
Expression System: 169-314aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN
Application Notes: Research Areas: Cancer