Recombinant Human Syntaxin-binding protein 3 (STXBP3)

Catalog Number: CSB-EP022907HU
Article Name: Recombinant Human Syntaxin-binding protein 3 (STXBP3)
Biozol Catalog Number: CSB-EP022907HU
Supplier Catalog Number: CSB-EP022907HU
Alternative Catalog Number: CSB-EP022907HU-1, CSB-EP022907HU-100, CSB-EP022907HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Platelet Sec1 protein,Protein unc-18 homolog 3,Protein unc-18 homolog C
Molecular Weight: 74.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O00186
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-592aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLHELTFQ
Application Notes: Research Areas: Immunology