Recombinant Human Tyrosine-protein kinase SYK (SYK)

Catalog Number: CSB-EP022998HU
Article Name: Recombinant Human Tyrosine-protein kinase SYK (SYK)
Biozol Catalog Number: CSB-EP022998HU
Supplier Catalog Number: CSB-EP022998HU
Alternative Catalog Number: CSB-EP022998HU-1, CSB-EP022998HU-100, CSB-EP022998HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Spleen tyrosine kinase,p72-Syk
Molecular Weight: 79.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P43405
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.72.
Source: E.coli
Expression System: 1-635aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVL
Application Notes: Research Areas: Immunology