Recombinant Human Transcription factor E2-alpha (TCF3), partial

Catalog Number: CSB-EP023301HU(F2)G6
Article Name: Recombinant Human Transcription factor E2-alpha (TCF3), partial
Biozol Catalog Number: CSB-EP023301HU(F2)G6
Supplier Catalog Number: CSB-EP023301HU(F2)g6
Alternative Catalog Number: CSB-EP023301HU(F2)G6-1, CSB-EP023301HU(F2)G6-100, CSB-EP023301HU(F2)G6-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Class B basic helix-loop-helix protein 21,Immunoglobulin enhancer-binding factor E12/E47,Immunoglobulin transcription factor 1,Kappa-E2-binding factor,Transcription factor 3,Transcription factor ITF-1
Molecular Weight: 37.6 kDa
Tag: N-terminal GST-tagged and C-terminal 6xHis-tagged
UniProt: P15923
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.243.
Source: E.coli
Expression System: 535-613aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAA
Application Notes: Research Areas: Immunology