Recombinant Mouse Thrombospondin-2 (Thbs2)

Catalog Number: CSB-EP023488MOC7
Article Name: Recombinant Mouse Thrombospondin-2 (Thbs2)
Biozol Catalog Number: CSB-EP023488MOC7
Supplier Catalog Number: CSB-EP023488MOc7
Alternative Catalog Number: CSB-EP023488MOC7-1, CSB-EP023488MOC7-100, CSB-EP023488MOC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Thbs2,Tsp2
Molecular Weight: 31.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q03350
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 19-232aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Application Notes: Research Areas: Others. Endotoxin: Not test