Recombinant Human Tolloid-like protein 1 (TLL1), partial

Catalog Number: CSB-EP023595HU
Article Name: Recombinant Human Tolloid-like protein 1 (TLL1), partial
Biozol Catalog Number: CSB-EP023595HU
Supplier Catalog Number: CSB-EP023595HU
Alternative Catalog Number: CSB-EP023595HU-1, CSB-EP023595HU-100, CSB-EP023595HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 30.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: O43897
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.204.
Source: E.coli
Expression System: 148-350aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACG
Application Notes: Research Areas: Developmental Biology