Recombinant Saccharomyces cerevisiae High mobility group protein 1 (HMO1)

Catalog Number: CSB-EP199576SVG
Article Name: Recombinant Saccharomyces cerevisiae High mobility group protein 1 (HMO1)
Biozol Catalog Number: CSB-EP199576SVG
Supplier Catalog Number: CSB-EP199576SVG
Alternative Catalog Number: CSB-EP199576SVG-1, CSB-EP199576SVG-100, CSB-EP199576SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: High spontaneous mutagenesis protein 2
Molecular Weight: 34.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q03973
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-246aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTTDPSVKLKSAKDSLVSSLFELSKAANQTASSIVDFYNAIGDDEEEKIEAFTTLTESLQTLTSGVNHLHGISSELVNPIDDDKDAIIAAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQKAGLPPLSSTEITQEISKKWKELSDNEKEKWKQAYNVELENYQREKSKYLEAKKNGTLPPASLENGPTHAPVPIPFSLQHAAEPPVEKRPHDDDGSSEKKKKKKKKDKKKDKSNSSI
Application Notes: Research Areas: Others. Endotoxin: Not test